General Information

  • ID:  hor005719
  • Uniprot ID:  Q9XSW6
  • Protein name:  Neuropeptide Y
  • Gene name:  NPY
  • Organism:  Macaca mulatta (Rhesus macaque)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0008343 adult feeding behavior; GO:0032100 positive regulation of appetite
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0031410 cytoplasmic vesicle; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
  • Length:  36
  • Propeptide:  MLGSKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPSMW
  • Signal peptide:  MLGSKRLGLSGLTLALSLLVCLGALAEA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPY1R, NPY2R
  • Target Unid:  Q9GK75, Q9GK74
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: ~ 20 (20-28) minutes; /1200 seconds ( PubMed ID: 3601235 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9XSW6-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005719_AF2.pdbhor005719_ESM.pdb

Physical Information

Mass: 489718 Formula: C189H284N54O58S
Absent amino acids: CFVW Common amino acids: Y
pI: 7.52 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 8
Hydrophobicity: -119.44 Boman Index: -10835
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 54.44
Instability Index: 6373.89 Extinction Coefficient cystines: 7450
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  3601235
  • Title:  NA